Iright
BRAND / VENDOR: Proteintech

Proteintech, 14859-1-AP, PSMB8 Polyclonal antibody

CATALOG NUMBER: 14859-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSMB8 (14859-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB8 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 14859-1-AP targets PSMB8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse kidney tissue, human kidney tissue Positive IP detected in: Raji cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PSMB8(Proteasome subunit beta type-8) is also named as LMP7, PSMB5i, RING10, Y2 and belongs to the peptidase T1B family. The gene encodes the chymotrypsin-like catalytic subunit of the immunoproteasome(PMID: 19525961). PSMB8 has a role in controlling pathogenic immune responses and may be a target in autoimmune disorders. Its prosequence is not essential for incorporation of PSMB8 into the maturing proteasome, but it increased the efficiency of PSMB8 incorporation and proteasome maturation(PMID: 10926487). The pro-PSMB8 is a 276aa protein with the molecular mass of 30 kDa, and the mature form is about 23kDa due to the 72aa propeptide cleaved. Defects in PSMB8 are the cause of Nakajo syndrome (NKJO). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6660 Product name: Recombinant human PSMB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC001114 Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC001114 Gene Symbol: PSMB8 Gene ID (NCBI): 5696 RRID: AB_2268923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28062 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924