Proteintech, 14862-1-AP, THOC5 Polyclonal antibody

Size: 20ul / 150ul The THOC5 (14862-1-AP) by Proteintech is a Polyclonal antibody targeting THOC5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14862-1-AP targets THOC5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:3000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information THOC5, also named as C22orf19, or KIAA0983, is a 683 amino acid protein, which belongs to the THOC5 family. THOC5 is ubiquitously expressed in many tissues. THOC5 localizes in the nucleus and acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA.THOC5 plays a role in cytokine-stimulated monocytic development and affects granulocyte/macrophage differentiation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6664 Product name: Recombinant human THOC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 354-683 aa of BC003615 Sequence: CKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTIAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPIFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR Predict reactive species Full Name: THO complex 5 Calculated Molecular Weight: 79 kDa Observed Molecular Weight: 79 kDa GenBank Accession Number: BC003615 Gene Symbol: THOC5 Gene ID (NCBI): 8563 RRID: AB_2878088 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.