Iright
BRAND / VENDOR: Proteintech

Proteintech, 14872-1-AP, SPCS2 Polyclonal antibody

CATALOG NUMBER: 14872-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPCS2 (14872-1-AP) by Proteintech is a Polyclonal antibody targeting SPCS2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14872-1-AP targets SPCS2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human colon tissue, mouse stomach tissue, rat colon tissue, mouse spleen tissue, mouse colon tissue, Jurkat cells Positive IP detected in: HeLa cells, mouse colon tissue Positive IHC detected in: human skin cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Signal peptidase complex subunit 2 (SPCS2) is multi-pass membrane protein as a component of the microsomal signal peptidase complex, which function to remove signal peptides from nascent proteins before translocation into the endoplasmic reticulum lumen. This protein was evidenced as a 25 kDa protein with function not well known. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6640 Product name: Recombinant human SPCS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC064957 Sequence: MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSVKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK Predict reactive species Full Name: signal peptidase complex subunit 2 homolog (S. cerevisiae) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC064957 Gene Symbol: SPCS2 Gene ID (NCBI): 9789 RRID: AB_2255321 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15005 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924