Product Description
Size: 20ul / 150ul
The SCLT1 (14875-1-AP) by Proteintech is a Polyclonal antibody targeting SCLT1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples
14875-1-AP targets SCLT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HEK-293 cells, mouse brain tissue, COLO 320 cells, rat brain tissue, HeLa cells
Positive IP detected in: human placenta tissue
Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: hTERT-RPE1 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:600-1:2400
Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag6646 Product name: Recombinant human SCLT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC064428 Sequence: MAAEIDFLREQNRRLNEDFRRYQMESFSKYSSVQKAVCQGEGDDTFENLVFDQSFLAPLVTEYDKHLGELNGQLKYYQA Predict reactive species
Full Name: sodium channel and clathrin linker 1
Calculated Molecular Weight: 81 kDa
Observed Molecular Weight: 36 kDa,75-80 kDa
GenBank Accession Number: BC064428
Gene Symbol: SCLT1
Gene ID (NCBI): 132320
RRID: AB_2183691
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96NL6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924