Product Description
Size: 20ul / 150ul
The VIPR1 (14878-1-AP) by Proteintech is a Polyclonal antibody targeting VIPR1 in WB, IHC, ELISA applications with reactivity to human, mouse samples
14878-1-AP targets VIPR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse small intestine tissue
Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human, mouse
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag6650 Product name: Recombinant human VIPR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-146 aa of BC064424 Sequence: AARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGY Predict reactive species
Full Name: vasoactive intestinal peptide receptor 1
Calculated Molecular Weight: 47 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC064424
Gene Symbol: VIPR1
Gene ID (NCBI): 7433
RRID: AB_2878089
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P32241
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924