Proteintech, 14878-1-AP, VIPR1 Polyclonal antibody

Size: 20ul / 150ul The VIPR1 (14878-1-AP) by Proteintech is a Polyclonal antibody targeting VIPR1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14878-1-AP targets VIPR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6650 Product name: Recombinant human VIPR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-146 aa of BC064424 Sequence: AARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGY Predict reactive species Full Name: vasoactive intestinal peptide receptor 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC064424 Gene Symbol: VIPR1 Gene ID (NCBI): 7433 RRID: AB_2878089 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.