Proteintech, 14901-1-AP, PECR Polyclonal antibody

Size: 20ul / 150ul The PECR (14901-1-AP) by Proteintech is a Polyclonal antibody targeting PECR in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 14901-1-AP targets PECR in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, human testis tissue, human kidney tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Peroxisomal trans-2-enoyl-CoA reductase (PECR) is also called TERP and TECR, which is located on chromosome q35 with 86627 bases. It can participate in carbon chain elongation in fatty acid metabolism and catalyze the last reaction of four long chain fatty acid elongation cycles. Each cycle of PECR adds two carbons to the long chain and very long chain fatty acid (VLCFA) chains, reducing the intermediate of trans-2,3-enoyl coenzyme A fatty acid to acyl coenzyme A, which can further extend the carbon chain by entering a new elongation cycle. Meanwhile, PECR is a peroxisome protein involved in fatty acid synthesis and plays an important role in milk fat synthesis. The molecular mass of PECR is 33 kDa. (PMID: 31467878) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6693 Product name: Recombinant human PECR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC002529 Sequence: MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL Predict reactive species Full Name: peroxisomal trans-2-enoyl-CoA reductase Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC002529 Gene Symbol: PECR Gene ID (NCBI): 55825 RRID: AB_2161166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BY49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.