Proteintech, 14902-1-AP, HKR1 Polyclonal antibody

Size: 20ul / 150ul The HKR1 (14902-1-AP) by Proteintech is a Polyclonal antibody targeting HKR1 in WB, ELISA applications with reactivity to human samples 14902-1-AP targets HKR1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information HKR1, also named as ZNF875, belongs to the krueppel C2H2-type zinc-finger protein family. HRK1 is a modular protein that comprises a photosensory rhodopsin, a histidine kinase, a response regulator and a putative guanylyl cyclase domain. HKR1 is related to the protonation state of the Schiff base function that provides the linkage of the retinal chromophore with a Lys side chain of the protein (PMID: 25836735). HRK1 has 2 isoforms with the molecular mass of 73-75 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6694 Product name: Recombinant human HKR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-599 aa of BC053845 Sequence: NLITHQRTHSGEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCKECGQSFSLKSNLITHQRAHTGEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICRECEQGFSQKSHLIRHLRTHTGEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVCLECGQCFSLKSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVCAECGRGFNDKSTLISHQRTHSGEKPFMCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRAHAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG Predict reactive species Full Name: GLI-Kruppel family member HKR1 Calculated Molecular Weight: 73 kDa, 75 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC053845 Gene Symbol: HKR1 Gene ID (NCBI): 284459 RRID: AB_2878091 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10072 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.