Iright
BRAND / VENDOR: Proteintech

Proteintech, 14912-1-AP, NDUFB7 Polyclonal antibody

CATALOG NUMBER: 14912-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NDUFB7 (14912-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB7 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14912-1-AP targets NDUFB7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, MCF-7 cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human brain tissue, human cervical cancer tissue, human heart tissue, human kidney tissue, human liver tissue, human lung tissue, human placenta tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information NDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6709 Product name: Recombinant human NDUFB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC002595 Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC002595 Gene Symbol: NDUFB7 Gene ID (NCBI): 4713 RRID: AB_2235903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924