Proteintech, 14915-1-AP, TOB1 Polyclonal antibody

Size: 20ul / 150ul The TOB1 (14915-1-AP) by Proteintech is a Polyclonal antibody targeting TOB1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14915-1-AP targets TOB1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.The predicted MW of this protein is 38 kDa. Catalog#14915-1-AP recognises 38 and 45 kDa band, and the additional 45 kDa band may be due to phosphorylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6714 Product name: Recombinant human TOB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC031406 Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN Predict reactive species Full Name: transducer of ERBB2, 1 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38-45 kDa GenBank Accession Number: BC031406 Gene Symbol: TOB1 Gene ID (NCBI): 10140 RRID: AB_10896496 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50616 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.