Iright
BRAND / VENDOR: Proteintech

Proteintech, 14920-1-AP, ATP6V1D Polyclonal antibody

CATALOG NUMBER: 14920-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATP6V1D (14920-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1D in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14920-1-AP targets ATP6V1D in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse skeletal muscle tissue, mouse lung tissue, rat lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ATP6V1D is also named as ATP6M, VATD(V-type proton ATPase subunit D) and belongs to the V-ATPase D subunit family. ATP6V1D gene has been under strong negative selection during evolution and is highly conserved among mammals, flies, worms, yeast, plants, and bacteria(PMID:11435709). It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6737 Product name: Recombinant human ATP6V1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC001411 Sequence: MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE Predict reactive species Full Name: ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC001411 Gene Symbol: ATP6V1D Gene ID (NCBI): 51382 RRID: AB_2243302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5K8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924