Iright
BRAND / VENDOR: Proteintech

Proteintech, 14922-1-AP, ICOSLG/B7-H2/CD275 Polyclonal antibody

CATALOG NUMBER: 14922-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ICOSLG/B7-H2/CD275 (14922-1-AP) by Proteintech is a Polyclonal antibody targeting ICOSLG/B7-H2/CD275 in WB, IHC, ELISA applications with reactivity to human samples 14922-1-AP targets ICOSLG/B7-H2/CD275 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, JAR cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ICOSLG, also known as B7H2 or GL50, is a type I transmembrane glycoprotein belonging to the B7 ligand family. ICOSLG is extensively expressed on professional antigen-presenting cells including B cells, macrophages, and dendritic cells, as well as non-lymphoid cells including mesenchymal stem cells, endothelial cells, fibroblasts, and tumor cells (PMID: 33756276; 35800767). It is a specific ligand for the T-cell-specific cell surface receptor ICOS and acts as a co-stimulatory molecule (PMID: 11023515; 11007762). The interaction of ICOSLG and ICOS plays important roles in the activation, proliferation, differentiation, and cytokine production of T cells as well as in the antibody secretion from B cells during secondary immune responses (PMID: 21851236). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6392 Product name: Recombinant human ICOSLG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC064637 Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV Predict reactive species Full Name: inducible T-cell co-stimulator ligand Calculated Molecular Weight: 33 kDa, 34 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC064637 Gene Symbol: ICOSLG Gene ID (NCBI): 23308 RRID: AB_2122732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75144 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924