Proteintech, 14926-1-AP, ANAPC5 Polyclonal antibody

Size: 20ul / 150ul The ANAPC5 (14926-1-AP) by Proteintech is a Polyclonal antibody targeting ANAPC5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14926-1-AP targets ANAPC5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, BxPC-3 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6688 Product name: Recombinant human ANAPC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-343 aa of BC001081 Sequence: MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHC Predict reactive species Full Name: anaphase promoting complex subunit 5 Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC001081 Gene Symbol: ANAPC5 Gene ID (NCBI): 51433 RRID: AB_2227073 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.