Iright
BRAND / VENDOR: Proteintech

Proteintech, 14930-1-AP, GCDH Polyclonal antibody

CATALOG NUMBER: 14930-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GCDH (14930-1-AP) by Proteintech is a Polyclonal antibody targeting GCDH in WB, IHC, ELISA applications with reactivity to human samples 14930-1-AP targets GCDH in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SH-SY5Y cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GCDH is a nuclear-encoded mitochondrial protein involved in the catabolic pathway of tryptophan, lysine and hydroxylysine. The functional enzyme is a homotetramer of 43.3 kDa subunits that resides in the mitochondrial matrix. GCDH activity reduction leads to predominant accumulation of glutaric (GA) and 3- hydroxyglutaric (3HGA) acids in tissues, mostly brain, and biological fluids of affected patients. GCDH is widely expressed and has the highest levels in liver and kidney, which is consistent with its role in amino acid oxidation. (PMID: 27984186, 33001399) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6713 Product name: Recombinant human GCDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-438 aa of BC002579 Sequence: LANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK Predict reactive species Full Name: glutaryl-Coenzyme A dehydrogenase Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 44-48 kDa GenBank Accession Number: BC002579 Gene Symbol: GCDH Gene ID (NCBI): 2639 RRID: AB_2878092 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92947 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924