Proteintech, 14931-1-AP, GNPAT Polyclonal antibody

Size: 20ul / 150ul The GNPAT (14931-1-AP) by Proteintech is a Polyclonal antibody targeting GNPAT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 14931-1-AP targets GNPAT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, human placenta tissue, Transfected HEK-293 cells, COLO 320 cells, HeLa cells, PC-3 cells, mouse brain tissue Positive IP detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information GNPAT, also named as DAPAT and DHAPAT, belongs to the GPAT/DAPAT family. It is a key enzyme in the biosynthesis of ether phospholipids. GNPAT is localized exclusively within peroxisomes. Full GNPAT activity depends not only on the presence of AGPS, but also on the integrity of substrate channeling from GNPAT to AGPS. (PMID:21990100) This antibody recognize the 69 kDa GNPAT protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6735 Product name: Recombinant human GNPAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-680 aa of BC000450 Sequence: PVSLRSLAAGRMSRSSYNLVPRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFGGFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKHLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL Predict reactive species Full Name: glyceronephosphate O-acyltransferase Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 65-69 kDa GenBank Accession Number: BC000450 Gene Symbol: GNPAT Gene ID (NCBI): 8443 RRID: AB_2110546 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.