Iright
BRAND / VENDOR: Proteintech

Proteintech, 14953-1-AP, SNX11 Polyclonal antibody

CATALOG NUMBER: 14953-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SNX11 (14953-1-AP) by Proteintech is a Polyclonal antibody targeting SNX11 in WB, ELISA applications with reactivity to human, mouse, rat samples 14953-1-AP targets SNX11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SNX11 belongs to the sorting nexin family of proteins which contain a phox (PX) domain. PX domain is a phosphoinositide binding domain. SNX family members are involved in intracellular trafficking. SNX11 protein lacks C-terminal coiled-coil motifs found in several other SNX family members. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6791 Product name: Recombinant human SNX11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC000768 Sequence: MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK Predict reactive species Full Name: sorting nexin 11 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC000768 Gene Symbol: SNX11 Gene ID (NCBI): 29916 RRID: AB_2878094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5W9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924