Proteintech, 14956-1-AP, BEGAIN Polyclonal antibody

Size: 20ul / 150ul The BEGAIN (14956-1-AP) by Proteintech is a Polyclonal antibody targeting BEGAIN in WB, IHC, ELISA applications with reactivity to human, mouse samples 14956-1-AP targets BEGAIN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, JAR cells, SH-SY5Y cells Positive IHC detected in: human pancreas cancer tissue, mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6794 Product name: Recombinant human BEGAIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-593 aa of BC002607 Sequence: DIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN Predict reactive species Full Name: brain-enriched guanylate kinase-associated homolog (rat) Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC002607 Gene Symbol: BEGAIN Gene ID (NCBI): 57596 RRID: AB_2064487 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.