Iright
BRAND / VENDOR: Proteintech

Proteintech, 14972-1-AP, LEF1 Polyclonal antibody

CATALOG NUMBER: 14972-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LEF1 (14972-1-AP) by Proteintech is a Polyclonal antibody targeting LEF1 in WB, IP, ELISA applications with reactivity to human samples 14972-1-AP targets LEF1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, COLO 320 cells, NCCIT cells Positive IP detected in: SW 1990 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Lymphoid enhancer-binding factor 1(LEF1) belongs to a family of regulatory proteins that share homology with high mobility group protein-1, and it's a nuclear protein expressed in pre-B and T cells. LEF1 has a role in the Wnt signaling pathway hair cell differentiation and follicle morphogenesis. Together with CTNNB1 and EP300, LEF1 activates transcription of target genes. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances the proliferation of pancreatic tumor cells. MECs can give rise to seven cell types of the SAE and SMGs following severe airway injury. MECs progressively adopted a basal cell phenotype on the SAE and established lasting progenitors capable of further regeneration following reinjury. MECs activate Wnt-regulated transcription factors (Lef-1/TCF7) following injury and Lef-1 induction in cultured MECs promotes transition to a basal cell phenotype. Surprisingly, dose-dependent MEC conditional activation of Lef-1in vivopromoted self-limited airway regeneration in the absence of injury. Thus, modulating the Lef-1 transcriptional program in MEC-derived progenitors may have regenerative medicine applications for lung diseases. (https://doi.org/10.1016/j.stem.2018.03.017) The phosphorylation may affect the LEF1 protein's theoretical molecular weight when tested.40-70 kD bands have also been reported (PMID: 22261717; 17063141 ). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6882 Product name: Recombinant human LEF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-399 aa of BC050632 Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI Predict reactive species Full Name: lymphoid enhancer-binding factor 1 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 50-55 kDa, 65 kDa GenBank Accession Number: BC050632 Gene Symbol: LEF1 Gene ID (NCBI): 51176 ENSEMBL Gene ID: ENSG00000138795 RRID: AB_2265677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924