Iright
BRAND / VENDOR: Proteintech

Proteintech, 14977-1-AP, SNRPF Polyclonal antibody

CATALOG NUMBER: 14977-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SNRPF (14977-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPF in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14977-1-AP targets SNRPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue, HeLa cells, HepG2 cells, MCF-7 cells, mouse kidney tissue, mouse liver tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The 4 major small nuclear ribonucleoprotein particles (snRNPs), U1, U2, U4/U6, and U5, are essential components of the eukaryotic pre-mRNA splicing machinery. These snRNPs share 8 proteins which form the snRNP structural core: B/B-prime (SNRPB), D1 (SNRPD1), D2 (SNRPD2), D3 (SNRPD3), E (SNRPE), F (SNRPF), and G (SNRPG). These proteins have a role in the biogenesis of the snRNPs. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6889 Product name: Recombinant human SNRPF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC002505 Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptide F Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC002505 Gene Symbol: SNRPF Gene ID (NCBI): 6636 RRID: AB_2302166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62306 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924