Iright
BRAND / VENDOR: Proteintech

Proteintech, 14993-1-AP, PCOLCE Polyclonal antibody

CATALOG NUMBER: 14993-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PCOLCE (14993-1-AP) by Proteintech is a Polyclonal antibody targeting PCOLCE in WB, IHC, ELISA applications with reactivity to human samples 14993-1-AP targets PCOLCE in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MG-63 cells, SH-SY5Y cells Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information PCOLCE (Procollagen C-endopeptidase enhancer 1), also named as PCPE1, is a secreted glycoprotein that functions as a positive regulator of procollagen processing. PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity. Procollagen C-proteinases have important roles in developmental processes and assembly of the extracellular matrix. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6979 Product name: Recombinant human PCOLCE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 169-449 aa of BC000574 Sequence: TLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD Predict reactive species Full Name: procollagen C-endopeptidase enhancer Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC000574 Gene Symbol: PCOLCE Gene ID (NCBI): 5118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15113 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924