Product Description
Size: 20ul / 150ul
The CNIH4 (15015-1-AP) by Proteintech is a Polyclonal antibody targeting CNIH4 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples
15015-1-AP targets CNIH4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse testis tissue, rat testis tissue
Positive IF-P detected in: mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Background Information
CNIH4 (Cornichon Family Member 4) is a protein-coding gene belonging to the cornichon family, which plays a critical role in regulating G protein-coupled receptor (GPCR) trafficking from the endoplasmic reticulum to the cell surface. It facilitates GPCR export through the early secretory pathway and is regulated by TMED9.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag6965 Product name: Recombinant human CNIH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC000573 Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLG Predict reactive species
Full Name: cornichon homolog 4 (Drosophila)
Calculated Molecular Weight: 16 kDa
Observed Molecular Weight: 16-18 kDa
GenBank Accession Number: BC000573
Gene Symbol: CNIH4
Gene ID (NCBI): 29097
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9P003
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924