Iright
BRAND / VENDOR: Proteintech

Proteintech, 15023-1-AP, CPSF4 Polyclonal antibody

CATALOG NUMBER: 15023-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CPSF4 (15023-1-AP) by Proteintech is a Polyclonal antibody targeting CPSF4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 15023-1-AP targets CPSF4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, HeLa cells, HEK-293 cells Positive IP detected in: HeLa cells Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information The mature 3-prime ends of cellular mRNAs are producted by endonucleolytic cleavage of the primary transcripts, followed by polyadenylation of the upstream cleavage products. The cleavage and polyadenylation specificity factor (CPSF) has a essential role in pre-mRNA 3-prime end processing in that it is required in both the cleavage step and subsequent poly(A) addition [PMID: 9651582]. CPSF4 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex, whose other components are CPSF1, CPSF2, CPSF3 and FIP1L1. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7103 Product name: Recombinant human CPSF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC003101 Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ Predict reactive species Full Name: cleavage and polyadenylation specific factor 4, 30kDa Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC003101 Gene Symbol: CPSF4 Gene ID (NCBI): 10898 RRID: AB_2084544 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95639 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924