Iright
BRAND / VENDOR: Proteintech

Proteintech, 15027-1-AP, NUP85 Polyclonal antibody

CATALOG NUMBER: 15027-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NUP85 (15027-1-AP) by Proteintech is a Polyclonal antibody targeting NUP85 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15027-1-AP targets NUP85 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HepG2 cells Positive IHC detected in: rat brain tissue, human stomach cancer tissue, mouse brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information This gene encodes a protein component of the Nup107-160 subunit of the nuclear pore complex. NPCs are key for nucleocytoplasmic transport, but also regulate the mitotic machinery, transcription and chromatin organization through transport-independent mechanisms. The NUP107-160 complex is acknowledged to contribute to the assembly and maintenance of the NPC structure. Members of this largest subcomplex of the NPC associate with kinetochores, mitotic spindles, centrosomes and mitotic checkpoint regulators for proper completion of the cell cycle . Downregulation of NUP107-160 subcomplex members resulted in defective cytokinesis, compromised microtubule structures, altered cytoskeletal dynamics, impaired chromosome segregation and differentiation. (PMID:34170319) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7158 Product name: Recombinant human Pericentrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 307-656 aa of BC000697 Sequence: FLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS Predict reactive species Full Name: nucleoporin 85kDa Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC000697 Gene Symbol: NUP85 Gene ID (NCBI): 79902 RRID: AB_3085449 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BW27 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924