Proteintech, 15029-1-AP, RAB3A Polyclonal antibody

Size: 20ul / 150ul The RAB3A (15029-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3A in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15029-1-AP targets RAB3A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, SH-SY5Y cells, human brain tissue, mouse cerebellum tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Rab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3A is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and/ or by recruiting regulatory molecules to the docking/ fusion machinery. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1903 Product name: Recombinant human RAB3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC011782 Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC Predict reactive species Full Name: RAB3A, member RAS oncogene family Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC011782 Gene Symbol: RAB3A Gene ID (NCBI): 5864 RRID: AB_2177378 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.