Iright
BRAND / VENDOR: Proteintech

Proteintech, 15057-1-AP, TPPP3 Polyclonal antibody

CATALOG NUMBER: 15057-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TPPP3 (15057-1-AP) by Proteintech is a Polyclonal antibody targeting TPPP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15057-1-AP targets TPPP3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, HEK-293 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TPPP3 (tubulin polymerization promoting protein 3), also named as TPPP/p20, is a new member of the TPPP family which binds tubulin and induces tubulin polymerization and microtubule bundling.TPPP3 has been shown to play an important role in cell proliferation and may be implicated in tumorigenesis and metastasis (19633818). TPPP3 was also identified as specific marker for the connective tissues that envelope tendons due to its distinct expression in the developing tendon sheath (19235716). This antibody detects the 19-20 kDa TPPP3 in HeLa and PC-3 cells. The non-specific bands between 40 and 60 kDa were also occasionally observed. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7040 Product name: Recombinant human TPPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC000691 Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK Predict reactive species Full Name: tubulin polymerization-promoting protein family member 3 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19-20 kDa GenBank Accession Number: BC000691 Gene Symbol: TPPP3 Gene ID (NCBI): 51673 RRID: AB_2878105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BW30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924