Proteintech, 15078-1-AP, PFDN5 Polyclonal antibody

Size: 20ul / 150ul The PFDN5 (15078-1-AP) by Proteintech is a Polyclonal antibody targeting PFDN5 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15078-1-AP targets PFDN5 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse pancreas tissue, PC-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:300-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7150 Product name: Recombinant human PFDN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC003373 Sequence: MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA Predict reactive species Full Name: prefoldin subunit 5 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC003373 Gene Symbol: PFDN5 Gene ID (NCBI): 5204 RRID: AB_2162703 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.