Iright
BRAND / VENDOR: Proteintech

Proteintech, 15086-1-AP, POLR2H Polyclonal antibody

CATALOG NUMBER: 15086-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POLR2H (15086-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2H in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15086-1-AP targets POLR2H in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, mouse kidney tissue, HeLa cells, MCF-7 cells, mouse liver tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information POLR2H, also known as hRPB8, is a 150 amino acid protein, which localizes in nucleolus and is expressed in 228 organ(s), highest expression level in mucosa of transverse colon. POLR2H. POLR2H is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR2H is a common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7166 Product name: Recombinant human POLR2H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC000739 Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Predict reactive species Full Name: polymerase (RNA) II (DNA directed) polypeptide H Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC000739 Gene Symbol: POLR2H Gene ID (NCBI): 5437 RRID: AB_2167826 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52434 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924