Proteintech, 15124-1-AP, GSTO1 Polyclonal antibody

Size: 20ul / 150ul The GSTO1 (15124-1-AP) by Proteintech is a Polyclonal antibody targeting GSTO1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15124-1-AP targets GSTO1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat brain tissue, mouse liver tissue, human heart tissue, U-937 cells, Jurkat cells, PC-3 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells. Human GSTO1 assembles as a dimer. This antibody detects both monomer (27-30 kDa) and dimer forms of GSTO1 (54-64 kDa). (PMID: 21495794) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7199 Product name: Recombinant human GSTO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC000127 Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL Predict reactive species Full Name: glutathione S-transferase omega 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC000127 Gene Symbol: GSTO1 Gene ID (NCBI): 9446 RRID: AB_2248132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78417 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.