Proteintech, 15128-1-AP, NHP2 Polyclonal antibody

Size: 20ul / 150ul The NHP2 (15128-1-AP) by Proteintech is a Polyclonal antibody targeting NHP2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15128-1-AP targets NHP2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Caco-2 cells, HeLa cells Positive IP detected in: HepG2 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information NHP2 belongs to the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. It is required for ribosome biogenesis and telomere maintenance, and for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme. Specification Tested Reactivity: human Cited Reactivity: human, mouse, yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7251 Product name: Recombinant human NHP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC000009 Sequence: MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL Predict reactive species Full Name: NHP2 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC000009 Gene Symbol: NHP2 Gene ID (NCBI): 55651 RRID: AB_2267290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX24 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.