Proteintech, 15131-1-AP, ATG4B Polyclonal antibody

Size: 20ul / 150ul The ATG4B (15131-1-AP) by Proteintech is a Polyclonal antibody targeting ATG4B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15131-1-AP targets ATG4B in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HuH-7 cells, HepG2 cells, Jurkat cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATG4B(autophagy 4) is also named as APG4B, AUTL1, KIAA0943 and belongs to the peptidase C54 family. It is a homolog of yeast Apg4, a cysteine protease involved in autophagy and is a cytoplasmic enzyme. This protein is highly expressed in skeletal muscle, with lower expression in heart, liver, and pancreas and no expression is detected in fetal tissues by the northern blot. ATG4B is widely expressed in tumor cell lines (PMID:12446702). It has some isoforms produced by alternative splicing with molecular mass of 31-52 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7261 Product name: Recombinant human ATG4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-393 aa of BC000719 Sequence: MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL Predict reactive species Full Name: ATG4 autophagy related 4 homolog B (S. cerevisiae) Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC000719 Gene Symbol: ATG4B Gene ID (NCBI): 23192 RRID: AB_2064405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4P1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.