Product Description
Size: 20ul / 150ul
The KCNE1 (15150-1-AP) by Proteintech is a Polyclonal antibody targeting KCNE1 in WB, IF, ELISA applications with reactivity to human, mouse, rat samples
15150-1-AP targets KCNE1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse kidney tissue
Positive IF detected in: mouse heart tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunofluorescence (IF): IF : 1:20-1:200
Background Information
Potassium voltage-gated channel subfamily E member 1 (KCNE1) is an ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE1 beta subunit modulates the gating kinetics and enhances stability of the channel complex (PMID: 19219384; 20533308; 9230439). The KCNQ1 + KCNE1 potassium channel complex generates the slow delayed rectifier current (IKs), which is critical for cardiac repolarization (PMID: 41034624).
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: rat, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag3495 Product name: Recombinant human KCNE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC036452 Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS Predict reactive species
Full Name: potassium voltage-gated channel, Isk-related family, member 1
Calculated Molecular Weight: 15 kDa
Observed Molecular Weight: 15 kDa
GenBank Accession Number: BC036452
Gene Symbol: KCNE1
Gene ID (NCBI): 3753
RRID: AB_2131977
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P15382
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924