Proteintech, 15163-1-AP, NANS Polyclonal antibody

Size: 20ul / 150ul The NANS (15163-1-AP) by Proteintech is a Polyclonal antibody targeting NANS in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15163-1-AP targets NANS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, human brain tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The sialic acids are a family of 9-carbon 2-keto-3-deoxy sugars. They are frequently the terminal sugars on secreted and cell surface glycoproteins and glycolipids. Sialic acids participate in many important biologic recognition events. NANS can also use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7271 Product name: Recombinant human NANS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-359 aa of BC000008 Sequence: MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS Predict reactive species Full Name: N-acetylneuraminic acid synthase Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC000008 Gene Symbol: NANS Gene ID (NCBI): 54187 RRID: AB_2150690 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.