Iright
BRAND / VENDOR: Proteintech

Proteintech, 15191-1-AP, COL4A3BP Polyclonal antibody

CATALOG NUMBER: 15191-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The COL4A3BP (15191-1-AP) by Proteintech is a Polyclonal antibody targeting COL4A3BP in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15191-1-AP targets COL4A3BP in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, mouse pancreas tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human pancreas tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COL4A3BP(Collagen type IV alpha-3-binding protein) is also named as CERT, STARD11. CERT extracts ceramide from the ER and carries it to the Golgi apparatus in a non-vesicular manner and that a particularly efficient cycle of CERT movement for trafficking of ceramide may proceed at membrane contact sites between the ER and the Golgi apparatus(PMID:17314061). This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7277 Product name: Recombinant human COL4A3BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 372-598 aa of BC000102 Sequence: EEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF Predict reactive species Full Name: collagen, type IV, alpha 3 (Goodpasture antigen) binding protein Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 80-89 kDa GenBank Accession Number: BC000102 Gene Symbol: COL4A3BP Gene ID (NCBI): 10087 RRID: AB_2082664 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5P4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924