Proteintech, 15196-1-AP, MED10 Polyclonal antibody

Size: 20ul / 150ul The MED10 (15196-1-AP) by Proteintech is a Polyclonal antibody targeting MED10 in WB, ELISA applications with reactivity to human, mouse, rat samples 15196-1-AP targets MED10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information MED10, also named as L6, TRG17, or TRG20, is a 135 amino acid protein, which belongs to the Mediator complex subunit 10 family. MED10 localizes in the nucleus and as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Multiprotein mediator complex acting as a coactivator is required for activation of RNA polymerase II transcription by DNA bound transcription factors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7336 Product name: Recombinant human MED10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC003353 Sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS Predict reactive species Full Name: mediator complex subunit 10 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC003353 Gene Symbol: MED10 Gene ID (NCBI): 84246 RRID: AB_2878117 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTT4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.