Proteintech, 15207-1-AP, CHAC1 Polyclonal antibody

Size: 20ul / 150ul The CHAC1 (15207-1-AP) by Proteintech is a Polyclonal antibody targeting CHAC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, hamster samples 15207-1-AP targets CHAC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, hamster samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, CHO cells, U-251 cells, C6 cells, RAW 264.7 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CHAC1(Cation transport regulator-like protein 1) was identified in a co-regulated group of genes enriched for components of the ATF4 (activating transcription factor 4) arm of the unfolded protein response pathway. CHAC1 is a proapoptotic ER stress protein downstream of the pancreatic EIF2α kinase-ATF4 pathway that appears to be important for human physiology and disease(PMID: 19109178). In addition, the study found that high CHAC1 expression is associated with a bad prognosis hinting that CHAC1 may have a possible prognostic significance in breast cancer(PMID: 35930144). The predicted molecular weight of CHAC1 is 24 kDa, and the molecular weight detected by Proteintech is 38 kDa (PMID: 39368995). Specification Tested Reactivity: human, mouse, rat, hamster Cited Reactivity: human, mouse, rat, chicken, yeast Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7360 Product name: Recombinant human CHAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC001847 Sequence: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV Predict reactive species Full Name: ChaC, cation transport regulator homolog 1 (E. coli) Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC001847 Gene Symbol: CHAC1 Gene ID (NCBI): 79094 RRID: AB_2878118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUX1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.