Proteintech, 15221-1-AP, TCTA Polyclonal antibody

Size: 20ul / 150ul The TCTA (15221-1-AP) by Proteintech is a Polyclonal antibody targeting TCTA in WB, ELISA applications with reactivity to human samples 15221-1-AP targets TCTA in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TCTA is required for cellular fusion during osteoclastogenesis. TCTA mRNA is expressed ubiquitously in normal tissues, with the highest levels of expression seen in the kidney. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7425 Product name: Recombinant human TCTA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC005157 Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE Predict reactive species Full Name: T-cell leukemia translocation altered gene Calculated Molecular Weight: 11 kDa GenBank Accession Number: BC005157 Gene Symbol: TCTA Gene ID (NCBI): 6988 RRID: AB_3085453 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57738 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.