Iright
BRAND / VENDOR: Proteintech

Proteintech, 15235-1-AP, SLC25A1 Polyclonal antibody

CATALOG NUMBER: 15235-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC25A1 (15235-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15235-1-AP targets SLC25A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, NCI-H1299 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissue, human lung cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7352 Product name: Recombinant human SLC25A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-311 aa of BC004980 Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC004980 Gene Symbol: SLC25A1 Gene ID (NCBI): 6576 RRID: AB_2254794 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924