Iright
BRAND / VENDOR: Proteintech

Proteintech, 15267-1-AP, ARL4D Polyclonal antibody

CATALOG NUMBER: 15267-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARL4D (15267-1-AP) by Proteintech is a Polyclonal antibody targeting ARL4D in WB, ELISA applications with reactivity to human, mouse, rat samples 15267-1-AP targets ARL4D in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse retina tissue, Y79 cells, rat retina tiissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ARL4D (ADP-ribosylation factor-like protein 4D) is also named as ARF4L. ARL4D is a developmentally regulated member of the ADP-ribosylation factor/ARF-like protein (ARF/ARL) family of Ras-related GTPases. ARL4D interacts with the C-terminal pleckstrin homology (PH) and polybasic c domains of cytohesin-2/ARNO in a GTP-dependent manner. Localization of ARL4D at the plasma membrane is GTP- and N-terminal myristoylation-dependent. ARL4D(Q80L), a putative active form of ARL4D, induced accumulation of cytohesin-2/ARNO at the plasma membrane  (PMID: 17804820). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7369 Product name: Recombinant human ARL4D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC000043 Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR Predict reactive species Full Name: ADP-ribosylation factor-like 4D Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC000043 Gene Symbol: ARL4D Gene ID (NCBI): 379 RRID: AB_3669203 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49703 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924