Proteintech, 15277-1-AP, MRPS25 Polyclonal antibody

Size: 20ul / 150ul The MRPS25 (15277-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS25 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15277-1-AP targets MRPS25 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Mitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7395 Product name: Recombinant human MRPS25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC003590 Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD Predict reactive species Full Name: mitochondrial ribosomal protein S25 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC003590 Gene Symbol: MRPS25 Gene ID (NCBI): 64432 RRID: AB_2180358 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P82663 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.