Iright
BRAND / VENDOR: Proteintech

Proteintech, 15280-1-AP, ATP6V1E1 Polyclonal antibody

CATALOG NUMBER: 15280-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATP6V1E1 (15280-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V1E1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 15280-1-AP targets ATP6V1E1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human liver tissue, human brain tissue, mouse brain tissue, HEK-293 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse testis tissue, human testis tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATP6V1E1, also named as ATP6E, ATP6E2 and p31, belongs to the V-ATPase E subunit family. It is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase and the lack of mycobacterial phagosome acidification are directly attributed to the Mtb protein tyrosine phosphatase PtpA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7399 Product name: Recombinant human ATP6V1E1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC004443 Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD Predict reactive species Full Name: ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC004443 Gene Symbol: ATP6V1E1 Gene ID (NCBI): 529 RRID: AB_2062545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36543 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924