Proteintech, 15294-1-AP, Perilipin-2 Polyclonal antibody

Size: 20ul / 150ul The Perilipin-2 (15294-1-AP) by Proteintech is a Polyclonal antibody targeting Perilipin-2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15294-1-AP targets Perilipin-2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, mouse liver tissue, 3T3-L1 cells, NIH/3T3 cells, rat liver tissue Positive IHC detected in: human liver cancer tissue, human renal cell carcinoma tissue, human liver tissue, human colon cancer tissue, human prostate cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: oleic acid treated HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:200-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ADRP (adipocyte differentiation related protein) also known as ADFP, adipophilin, or perilipin-2, is a member of PAT family which is responsible for the transportation of lipids and the formation of lipid droplets. ADRP is localized on the surface of lipid droplets in a variety of tissues and cell lines. ADRP is not detected in undifferentiated cells but increases rapidly to high levels when adipocyte precursors differentiate into adipocytes. Anti-ADRP antibody is a reliable and sensitive marker for lipid droplet. Enhanced expression of ADRP is linked to diseases with abnormal lipid storage, including hepatic steatosis, atherosclerosis and diabetes. Immunohistochemistry of ADRP may facilitate histomorphological diagnosis of these diseases. This antibody is not suitable for immunofluorescence staining of frozen sections. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine, monkey, zebrafish, bovine, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7539 Product name: Recombinant human ADRP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 88-437 aa of BC005127 Sequence: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH Predict reactive species Full Name: adipose differentiation-related protein Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC005127 Gene Symbol: Perilipin-2 Gene ID (NCBI): 123 RRID: AB_2878122 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.