Proteintech, 15357-1-AP, Cyclophilin E Polyclonal antibody

Size: 20ul / 150ul The Cyclophilin E (15357-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclophilin E in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15357-1-AP targets Cyclophilin E in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, Jurkat cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cyclophilin E (CypE), also known as Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily (PMID: 15998457). Cyclophilin E negatively regulates influenza virus replication and transcription occurs by impairing the formation of the vRNP (PMID: 21887220). Additionally, Cyclophilin E plays an important role in osteoblast differentiation as a positive regulator by increasing the transcriptional activity of Runx2 (PMID: 37947627). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7603 Product name: Recombinant human PPIE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC004898 Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV Predict reactive species Full Name: peptidylprolyl isomerase E (cyclophilin E) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC004898 Gene Symbol: Cyclophilin E Gene ID (NCBI): 10450 RRID: AB_2878131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNP9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.