Iright
BRAND / VENDOR: Proteintech

Proteintech, 15362-1-AP, TAF1A Polyclonal antibody

CATALOG NUMBER: 15362-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TAF1A (15362-1-AP) by Proteintech is a Polyclonal antibody targeting TAF1A in WB, ELISA applications with reactivity to human samples 15362-1-AP targets TAF1A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TAF1A, also named as TAFI48 and SL1, is a component of the transcription factor SL1/TIF-IB complex. TAF1A has two isoform with MW 40 kDa and 48-52 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8059 Product name: Recombinant human TAF1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 96-450 aa of BC013808 Sequence: PEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNAVAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLYNFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWKYLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL Predict reactive species Full Name: TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 48-52 kDa GenBank Accession Number: BC013808 Gene Symbol: TAF1A Gene ID (NCBI): 9015 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15573 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924