Iright
BRAND / VENDOR: Proteintech

Proteintech, 15363-1-AP, ST6GALNAC1 Polyclonal antibody

CATALOG NUMBER: 15363-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ST6GALNAC1 (15363-1-AP) by Proteintech is a Polyclonal antibody targeting ST6GALNAC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15363-1-AP targets ST6GALNAC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse small intestine tissue, rat colon tissue, rat small intestine tissue Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ST6GALNAC1 encodes a sialyltransferase that acts as a catalyst for the synthesis of cancer-related sialylTn (sTn) antigen critical for cell mobility.ST6GALNAC1 was overexpressed in gastric, breast and prostate cancer cell lines, inducing sTn expression. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8062 Product name: Recombinant human ST6GALNAC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-471 aa of BC022462 Sequence: QRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTKGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPNLTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSLRCITCAVVGNGGILNNSHIGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKAQTPGSFSGSPAHGQVPVAAPRLSPIHEEQVSEV Predict reactive species Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 66-69 kDa GenBank Accession Number: BC022462 Gene Symbol: ST6GALNAC1 Gene ID (NCBI): 55808 RRID: AB_2286578 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924