Iright
BRAND / VENDOR: Proteintech

Proteintech, 15365-1-AP, IFN-gamma Polyclonal antibody

CATALOG NUMBER: 15365-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IFN-gamma (15365-1-AP) by Proteintech is a Polyclonal antibody targeting IFN-gamma in WB, IHC, ELISA applications with reactivity to human samples 15365-1-AP targets IFN-gamma in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells, Recombinant protein Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IFN gamma (IFNG) is a soluble cytokine that is the only member of the type II class of IFN. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia. Specification Tested Reactivity: human Cited Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8321 Product name: Recombinant human IFNG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-166 aa of BC070256 Sequence: YCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ Predict reactive species Full Name: IFN gamma Calculated Molecular Weight: 166 aa, 19 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC070256 Gene Symbol: IFNG Gene ID (NCBI): 3458 ENSEMBL Gene ID: ENSG00000111537 RRID: AB_2123037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924