Proteintech, 15376-1-AP, SPTLC1 Polyclonal antibody

Size: 20ul / 150ul The SPTLC1 (15376-1-AP) by Proteintech is a Polyclonal antibody targeting SPTLC1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15376-1-AP targets SPTLC1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, human liver tissue, HeLa cells, HepG2 cells, L02 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SPTLC1 is a subunit of serine palmitoyltransferase (SPT) which is the key enzyme in sphingolipid biosynthesis and is essential for embryogenesis and cell survival. Mutations in the SPTLC1 gene (C133W, C133Y, V144D, and G387A) were reported to be responsible for the development of an inherited sensory neuropathy (hereditary sensory neuropathy type I, HSN1) (PMID: 39959268). Pathogenic variants in SPTLC1 are causative for hereditary sensory and autonomic neuropathy, juvenile amyotrophic lateral sclerosis, macular telangiectasia type 2, or Charcot-Marie-Tooth disease (PMID: 31751474). Western blot analysis detected a specific band at ~53 kDa (PMID: 36197001). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1162 Product name: Recombinant human SPTLC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC007085 Sequence: MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE Predict reactive species Full Name: serine palmitoyltransferase, long chain base subunit 1 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC007085 Gene Symbol: SPTLC1 Gene ID (NCBI): 10558 RRID: AB_2286678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15269 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.