Iright
BRAND / VENDOR: Proteintech

Proteintech, 15380-1-AP, NDP Polyclonal antibody

CATALOG NUMBER: 15380-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NDP (15380-1-AP) by Proteintech is a Polyclonal antibody targeting NDP in WB, ELISA applications with reactivity to human, mouse samples 15380-1-AP targets NDP in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information NDP, also named as EVR2, ND and Norrin, is a secreted regulatory protein that remains tightly associated with the extracellular matrix. Mutations in the NDP gene are associated with the Norrie disease. Signaling induced by the protein NDP regulates vascular development of vertebrate retina and controls important blood vessels in the ear. It binds with high affinity to Frizzled 4, and Frizzled 4 knockout mice exhibit abnormal vascular development of the retina. This antibody detects 11-15 kDa (monomer) and 48 kDa (polymers, refer: 25692504). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4066 Product name: Recombinant human NDP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC029901 Sequence: MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS Predict reactive species Full Name: Norrie disease (pseudoglioma) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC029901 Gene Symbol: NDP Gene ID (NCBI): 4693 RRID: AB_2878133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00604 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924