Iright
BRAND / VENDOR: Proteintech

Proteintech, 15396-1-AP, MYL10 Polyclonal antibody

CATALOG NUMBER: 15396-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MYL10 (15396-1-AP) by Proteintech is a Polyclonal antibody targeting MYL10 in WB, ELISA applications with reactivity to human, mouse, rat samples 15396-1-AP targets MYL10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information In non-muscle cells, MLCs are either regulatory (RLC) or essential ELCs. The human RLC gene family encompasses MYL2, MYL5, MYL9, MYL10, MYL11, MYL12A, and MYL12B , with the ELC gene family including MYL1 , MYL3, MYL4, and MYL6(PMID: 39768172). MYL10, also known as PLRLC, encodes for an RLC that might be a lymphocyte specific precursor. MYL10 is a regulatory myosin light chain that is expressed in pre-B cells from adult bone marrow, but not those from fetal liver, upon exposure to IL-7(PMID: 1628631). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7594 Product name: Recombinant human MYL10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC002778 Sequence: MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD Predict reactive species Full Name: myosin, light chain 10, regulatory Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC002778 Gene Symbol: MYL10 Gene ID (NCBI): 93408 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924