Product Description
Size: 20ul / 150ul
The YPEL3 (15403-1-AP) by Proteintech is a Polyclonal antibody targeting YPEL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
15403-1-AP targets YPEL3 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: BxPC-3 cells
Positive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
YPEL3 is part of a five-member family of closely related paralogues: YPEL1-5, which are named in reference to their Drosophila ortholgue. Studies showed shat YPEL3 is regulated by p53 and its encoding protein induces cellular senescence in human tumor and normal cells, indicating that YPEL3 is a p53-dependent, tumor suppressor gene. (PMID:20388804) 15403-1-AP was raised against full length of YPEL3 protein (1-119aa); it can recognize YPEL1-4.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag7626 Product name: Recombinant human YPEL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC005009 Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD Predict reactive species
Full Name: yippee-like 3 (Drosophila)
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC005009
Gene Symbol: YPEL3
Gene ID (NCBI): 83719
RRID: AB_11042587
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P61236
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924