Iright
BRAND / VENDOR: Proteintech

Proteintech, 15408-1-AP, ATP5E Polyclonal antibody

CATALOG NUMBER: 15408-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATP5E (15408-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5E in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 15408-1-AP targets ATP5E in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, 37℃ incubated mouse heart tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ATP synthase epsilon subunit (ATP5E) is an important subunit of ATP synthase, which is located in the stalk region of the F1 sector. F1-ATPase is the catalytic portion of mitochondrial ATP synthase, which produces ATP from ADP and inorganic phosphate (Pi). ATP5E is widely expressed in tissues. The calculated molecular weight of ATP5E is 6 kDa (PMID: 36625260). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7672 Product name: Recombinant human ATP5E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC001690 Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit Calculated Molecular Weight: 6 kDa Observed Molecular Weight: 6 kDa GenBank Accession Number: BC001690 Gene Symbol: ATP5E Gene ID (NCBI): 514 RRID: AB_3085461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56381 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924