Proteintech, 15413-1-AP, SYT17 Polyclonal antibody

Size: 20ul / 150ul The SYT17 (15413-1-AP) by Proteintech is a Polyclonal antibody targeting SYT17 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15413-1-AP targets SYT17 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human brain tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SYT17, or synaptotagmin 17, is a protein that belongs to the synaptotagmin family, which is known for its role in regulating exocytosis at the plasma membrane. Reports find high levels of expression in hippocampus, particularly in pyramidal cell layers and in cultured hippocampal neurons. SYT17 is thus a multifunctional regulator of intracellular protein trafficking in excitatory hippocampal neurons, modulating both neural development and synaptic physiology. (PMID: 31387992, PMID: 36332665) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7691 Product name: Recombinant human SYT17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 127-474 aa of BC004518 Sequence: IEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT Predict reactive species Full Name: synaptotagmin XVII Calculated Molecular Weight: 54 kDa GenBank Accession Number: BC004518 Gene Symbol: SYT17 Gene ID (NCBI): 51760 RRID: AB_2199457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSW7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.